SCOP 1.73: Domain d1xffb_: 1xff B:

Lineage for d1xffb_ (1xff B:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (6 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.1: Class II glutamine amidotransferases [56236] (6 proteins)
   has slightly different topology than other families do

6. Protein Glucosamine 6-phosphate synthase, N-terminal domain [56237] (1 species)

7. Species Escherichia coli [TaxId:562] [56238] (5 PDB entries)

8. Domain d1xffb_: 1xff B: [109581]
   complexed with act, glu, na

Details for d1xffb_

PDB Entry: 1xff, 1.8 Å

PDB Description: glutaminase domain of glucosamine 6-phosphate synthase complexed with glutamate

PDB Compounds: (B:) glucosamine--fructose-6-phosphate aminotransferase [isomerizing]

SCOP Domain Sequences for d1xffb_:

Sequence; same for both SEQRES and ATOM records:

>d1xffb_ d.153.1.1 (B:) Glucosamine 6-phosphate synthase, N-terminal domain {Escherichia coli [TaxId: 562]}
cgivgaiaqrdvaeilleglrrleyrgydsaglavvdaeghmtrlrrlgkvqmlaqaaee
hplhggtgiahtrwathgepsevnahphvsehivvvhngiienheplreelkargytfvs
etdteviahlvnwelkqggtlreavlraipqlrgaygtvimdsrhpdtllaarsgsplvi
glgmgenfiasdqlallpvtrrfifleegdiaeitrrsvnifdktgaevkrqdiesnlq

Timeline for d1xffb_:

• d1xffb_ first appeared in SCOP 1.69
  
• d1xffb_ appears in SCOP 1.71
  
• d1xffb_ appears in SCOP 1.75
  
• d1xffb_ appears in the current release, SCOPe 2.08