Lineage for d1xead2 (1xea D:123-266)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2961609Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2961610Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 2962135Family d.81.1.5: Glucose 6-phosphate dehydrogenase-like [55376] (7 proteins)
    has many additional secondary structures
  6. 2962214Protein Putative oxidoreductase VCA1048 [111054] (1 species)
  7. 2962215Species Vibrio cholerae [TaxId:666] [111055] (1 PDB entry)
    Uniprot Q9KKQ4
  8. 2962219Domain d1xead2: 1xea D:123-266 [109579]
    Other proteins in same PDB: d1xeaa1, d1xeaa3, d1xeab1, d1xeab3, d1xeac1, d1xeac3, d1xead1, d1xead3
    complexed with ni

Details for d1xead2

PDB Entry: 1xea (more details), 2.65 Å

PDB Description: crystal structure of a gfo/idh/moca family oxidoreductase from vibrio cholerae
PDB Compounds: (D:) Oxidoreductase, Gfo/Idh/MocA family

SCOPe Domain Sequences for d1xead2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xead2 d.81.1.5 (D:123-266) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]}
rrhiplynqhlselaqqecgalrslrwekhrhalpgdirtfvfddfihpldsvnlsrqcn
lddlhltyhmsegllarldvqwqtgdtllhasmnrqfgittehvtasydnvaylfdsftq
gkmwrdnqesrvalkdwtpmlask

SCOPe Domain Coordinates for d1xead2:

Click to download the PDB-style file with coordinates for d1xead2.
(The format of our PDB-style files is described here.)

Timeline for d1xead2: