Lineage for d1xead1 (1xea D:2-122,D:267-312)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 574151Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 574152Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 575085Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (18 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 575481Protein Putative oxidoreductase VCA1048 [110425] (1 species)
  7. 575482Species Vibrio cholerae [TaxId:666] [110426] (1 PDB entry)
  8. 575486Domain d1xead1: 1xea D:2-122,D:267-312 [109578]
    Other proteins in same PDB: d1xeaa2, d1xeab2, d1xeac2, d1xead2
    complexed with ni

Details for d1xead1

PDB Entry: 1xea (more details), 2.65 Å

PDB Description: Crystal structure of a Gfo/Idh/MocA family oxidoreductase from Vibrio cholerae

SCOP Domain Sequences for d1xead1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xead1 c.2.1.3 (D:2-122,D:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae}
slkiamiglgdiaqkaylpvlaqwpdielvlctrnpkvlgtlatryrvsatctdyrdvlq
ygvdavmihaatdvhstlaafflhlgiptfvdkplaasaqecenlyelaekhhqplyvgf
nXgfdamvqdwlqvaaagklpthiiernlashqlaeaicqqitqqvtk

SCOP Domain Coordinates for d1xead1:

Click to download the PDB-style file with coordinates for d1xead1.
(The format of our PDB-style files is described here.)

Timeline for d1xead1: