| Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) ![]() |
| Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (17 proteins) family members also share a common alpha+beta fold in C-terminal domain |
| Protein Putative oxidoreductase VCA1048 [110425] (1 species) |
| Species Vibrio cholerae [TaxId:666] [110426] (1 PDB entry) |
| Domain d1xead1: 1xea D:2-122,D:267-312 [109578] Other proteins in same PDB: d1xeaa2, d1xeab2, d1xeac2, d1xead2 |
PDB Entry: 1xea (more details), 2.65 Å
SCOP Domain Sequences for d1xead1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xead1 c.2.1.3 (D:2-122,D:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae}
slkiamiglgdiaqkaylpvlaqwpdielvlctrnpkvlgtlatryrvsatctdyrdvlq
ygvdavmihaatdvhstlaafflhlgiptfvdkplaasaqecenlyelaekhhqplyvgf
nXgfdamvqdwlqvaaagklpthiiernlashqlaeaicqqitqqvtk
Timeline for d1xead1: