SCOP 1.69: Domain d1xead1: 1xea D:2-122,D:267-312

Lineage for d1xead1 (1xea D:2-122,D:267-312)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (17 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Putative oxidoreductase VCA1048 [110425] (1 species)

7. Species Vibrio cholerae [TaxId:666] [110426] (1 PDB entry)

8. Domain d1xead1: 1xea D:2-122,D:267-312 [109578]
   Other proteins in same PDB: d1xeaa2, d1xeab2, d1xeac2, d1xead2

Details for d1xead1

PDB Entry: 1xea, 2.65 Å

PDB Description: crystal structure of a gfo/idh/moca family oxidoreductase from vibrio cholerae

SCOP Domain Sequences for d1xead1:

Sequence; same for both SEQRES and ATOM records:

>d1xead1 c.2.1.3 (D:2-122,D:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae}
slkiamiglgdiaqkaylpvlaqwpdielvlctrnpkvlgtlatryrvsatctdyrdvlq
ygvdavmihaatdvhstlaafflhlgiptfvdkplaasaqecenlyelaekhhqplyvgf
nXgfdamvqdwlqvaaagklpthiiernlashqlaeaicqqitqqvtk

Timeline for d1xead1:

• d1xead1 is new in SCOP 1.69
  
• d1xead1 appears in SCOP 1.71
  
• d1xead1 appears in the current release, SCOPe 2.08