Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) N-terminal domain is the classic Rossmann-fold |
Family d.81.1.5: Glucose 6-phosphate dehydrogenase-like [55376] (7 proteins) has many additional secondary structures |
Protein Putative oxidoreductase VCA1048 [111054] (1 species) |
Species Vibrio cholerae [TaxId:666] [111055] (1 PDB entry) Uniprot Q9KKQ4 |
Domain d1xeac2: 1xea C:123-266 [109577] Other proteins in same PDB: d1xeaa1, d1xeab1, d1xeac1, d1xead1 complexed with ni |
PDB Entry: 1xea (more details), 2.65 Å
SCOPe Domain Sequences for d1xeac2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xeac2 d.81.1.5 (C:123-266) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} rrhiplynqhlselaqqecgalrslrwekhrhalpgdirtfvfddfihpldsvnlsrqcn lddlhltyhmsegllarldvqwqtgdtllhasmnrqfgittehvtasydnvaylfdsftq gkmwrdnqesrvalkdwtpmlask
Timeline for d1xeac2: