![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
![]() | Protein Putative oxidoreductase VCA1048 [110425] (1 species) |
![]() | Species Vibrio cholerae [TaxId:666] [110426] (1 PDB entry) Uniprot Q9KKQ4 |
![]() | Domain d1xeac1: 1xea C:4-122,C:267-312 [109576] Other proteins in same PDB: d1xeaa2, d1xeaa3, d1xeab2, d1xeab3, d1xeac2, d1xeac3, d1xead2, d1xead3 complexed with ni has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1xea (more details), 2.65 Å
SCOPe Domain Sequences for d1xeac1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xeac1 c.2.1.3 (C:4-122,C:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} kiamiglgdiaqkaylpvlaqwpdielvlctrnpkvlgtlatryrvsatctdyrdvlqyg vdavmihaatdvhstlaafflhlgiptfvdkplaasaqecenlyelaekhhqplyvgfnX gfdamvqdwlqvaaagklpthiiernlashqlaeaicqqitqqvtk
Timeline for d1xeac1: