| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) ![]() N-terminal domain is the classic Rossmann-fold |
| Family d.81.1.5: Glucose 6-phosphate dehydrogenase-like [55376] (7 proteins) has many additional secondary structures |
| Protein Putative oxidoreductase VCA1048 [111054] (1 species) |
| Species Vibrio cholerae [TaxId:666] [111055] (1 PDB entry) Uniprot Q9KKQ4 |
| Domain d1xeab2: 1xea B:123-266 [109575] Other proteins in same PDB: d1xeaa1, d1xeaa3, d1xeab1, d1xeab3, d1xeac1, d1xeac3, d1xead1, d1xead3 complexed with ni |
PDB Entry: 1xea (more details), 2.65 Å
SCOPe Domain Sequences for d1xeab2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xeab2 d.81.1.5 (B:123-266) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]}
rrhiplynqhlselaqqecgalrslrwekhrhalpgdirtfvfddfihpldsvnlsrqcn
lddlhltyhmsegllarldvqwqtgdtllhasmnrqfgittehvtasydnvaylfdsftq
gkmwrdnqesrvalkdwtpmlask
Timeline for d1xeab2: