Lineage for d1xeab2 (1xea B:123-266)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 606541Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 606542Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 606896Family d.81.1.5: Glucose 6-phosphate dehydrogenase-like [55376] (5 proteins)
    has many additional secondary structures
  6. 606952Protein Putative oxidoreductase VCA1048 [111054] (1 species)
  7. 606953Species Vibrio cholerae [TaxId:666] [111055] (1 PDB entry)
  8. 606955Domain d1xeab2: 1xea B:123-266 [109575]
    Other proteins in same PDB: d1xeaa1, d1xeab1, d1xeac1, d1xead1

Details for d1xeab2

PDB Entry: 1xea (more details), 2.65 Å

PDB Description: Crystal structure of a Gfo/Idh/MocA family oxidoreductase from Vibrio cholerae

SCOP Domain Sequences for d1xeab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xeab2 d.81.1.5 (B:123-266) Putative oxidoreductase VCA1048 {Vibrio cholerae}
rrhiplynqhlselaqqecgalrslrwekhrhalpgdirtfvfddfihpldsvnlsrqcn
lddlhltyhmsegllarldvqwqtgdtllhasmnrqfgittehvtasydnvaylfdsftq
gkmwrdnqesrvalkdwtpmlask

SCOP Domain Coordinates for d1xeab2:

Click to download the PDB-style file with coordinates for d1xeab2.
(The format of our PDB-style files is described here.)

Timeline for d1xeab2: