SCOP 1.71: Domain d1xeab2: 1xea B:123-266

Lineage for d1xeab2 (1xea B:123-266)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.5: Glucose 6-phosphate dehydrogenase-like [55376] (5 proteins)
   has many additional secondary structures

6. Protein Putative oxidoreductase VCA1048 [111054] (1 species)

7. Species Vibrio cholerae [TaxId:666] [111055] (1 PDB entry)

8. Domain d1xeab2: 1xea B:123-266 [109575]
   Other proteins in same PDB: d1xeaa1, d1xeab1, d1xeac1, d1xead1

Details for d1xeab2

PDB Entry: 1xea, 2.65 Å

PDB Description: crystal structure of a gfo/idh/moca family oxidoreductase from vibrio cholerae

SCOP Domain Sequences for d1xeab2:

Sequence; same for both SEQRES and ATOM records:

>d1xeab2 d.81.1.5 (B:123-266) Putative oxidoreductase VCA1048 {Vibrio cholerae}
rrhiplynqhlselaqqecgalrslrwekhrhalpgdirtfvfddfihpldsvnlsrqcn
lddlhltyhmsegllarldvqwqtgdtllhasmnrqfgittehvtasydnvaylfdsftq
gkmwrdnqesrvalkdwtpmlask

Timeline for d1xeab2:

• d1xeab2 first appeared in SCOP 1.69
  
• d1xeab2 appears in SCOP 1.73
  
• d1xeab2 appears in the current release, SCOPe 2.08