Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
Protein Putative oxidoreductase VCA1048 [110425] (1 species) |
Species Vibrio cholerae [TaxId:666] [110426] (1 PDB entry) Uniprot Q9KKQ4 |
Domain d1xeab1: 1xea B:4-122,B:267-312 [109574] Other proteins in same PDB: d1xeaa2, d1xeaa3, d1xeab2, d1xeab3, d1xeac2, d1xeac3, d1xead2, d1xead3 complexed with ni |
PDB Entry: 1xea (more details), 2.65 Å
SCOPe Domain Sequences for d1xeab1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xeab1 c.2.1.3 (B:4-122,B:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} kiamiglgdiaqkaylpvlaqwpdielvlctrnpkvlgtlatryrvsatctdyrdvlqyg vdavmihaatdvhstlaafflhlgiptfvdkplaasaqecenlyelaekhhqplyvgfnX gfdamvqdwlqvaaagklpthiiernlashqlaeaicqqitqqvtk
Timeline for d1xeab1: