Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) N-terminal domain is the classic Rossmann-fold |
Family d.81.1.5: Glucose 6-phosphate dehydrogenase-like [55376] (4 proteins) has many additional secondary structures |
Protein Putative oxidoreductase VCA1048 [111054] (1 species) |
Species Vibrio cholerae [TaxId:666] [111055] (1 PDB entry) |
Domain d1xeaa2: 1xea A:123-266 [109573] Other proteins in same PDB: d1xeaa1, d1xeab1, d1xeac1, d1xead1 |
PDB Entry: 1xea (more details), 2.65 Å
SCOP Domain Sequences for d1xeaa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xeaa2 d.81.1.5 (A:123-266) Putative oxidoreductase VCA1048 {Vibrio cholerae} rrhiplynqhlselaqqecgalrslrwekhrhalpgdirtfvfddfihpldsvnlsrqcn lddlhltyhmsegllarldvqwqtgdtllhasmnrqfgittehvtasydnvaylfdsftq gkmwrdnqesrvalkdwtpmlask
Timeline for d1xeaa2: