Lineage for d1xeaa2 (1xea A:123-266)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 506899Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 506900Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 507247Family d.81.1.5: Glucose 6-phosphate dehydrogenase-like [55376] (4 proteins)
    has many additional secondary structures
  6. 507299Protein Putative oxidoreductase VCA1048 [111054] (1 species)
  7. 507300Species Vibrio cholerae [TaxId:666] [111055] (1 PDB entry)
  8. 507301Domain d1xeaa2: 1xea A:123-266 [109573]
    Other proteins in same PDB: d1xeaa1, d1xeab1, d1xeac1, d1xead1

Details for d1xeaa2

PDB Entry: 1xea (more details), 2.65 Å

PDB Description: crystal structure of a gfo/idh/moca family oxidoreductase from vibrio cholerae

SCOP Domain Sequences for d1xeaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xeaa2 d.81.1.5 (A:123-266) Putative oxidoreductase VCA1048 {Vibrio cholerae}
rrhiplynqhlselaqqecgalrslrwekhrhalpgdirtfvfddfihpldsvnlsrqcn
lddlhltyhmsegllarldvqwqtgdtllhasmnrqfgittehvtasydnvaylfdsftq
gkmwrdnqesrvalkdwtpmlask

SCOP Domain Coordinates for d1xeaa2:

Click to download the PDB-style file with coordinates for d1xeaa2.
(The format of our PDB-style files is described here.)

Timeline for d1xeaa2: