Lineage for d1xdgb_ (1xdg B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2500013Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2500014Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 2500015Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins)
  6. 2500089Protein Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) [53302] (1 species)
  7. 2500090Species Human (Homo sapiens) [TaxId:9606] [53303] (26 PDB entries)
    Uniprot P20701 153-334
  8. 2500108Domain d1xdgb_: 1xdg B: [109570]
    complexed with ab8, mg

Details for d1xdgb_

PDB Entry: 1xdg (more details), 2.1 Å

PDB Description: X-ray structure of LFA-1 I-domain in complex with LFA878 at 2.1A resolution
PDB Compounds: (B:) Integrin alpha-L

SCOPe Domain Sequences for d1xdgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xdgb_ c.62.1.1 (B:) Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) {Human (Homo sapiens) [TaxId: 9606]}
gnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfsdyv
kwkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgn
idaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelqkkiy
vi

SCOPe Domain Coordinates for d1xdgb_:

Click to download the PDB-style file with coordinates for d1xdgb_.
(The format of our PDB-style files is described here.)

Timeline for d1xdgb_: