Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
Fold c.62: vWA-like [53299] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.62.1: vWA-like [53300] (4 families) |
Family c.62.1.1: Integrin A (or I) domain [53301] (10 proteins) |
Protein Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) [53302] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [53303] (13 PDB entries) |
Domain d1xdgb_: 1xdg B: [109570] |
PDB Entry: 1xdg (more details), 2.1 Å
SCOP Domain Sequences for d1xdgb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xdgb_ c.62.1.1 (B:) Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) {Human (Homo sapiens)} gnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfsdyv kwkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgn idaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelqkkiy vi
Timeline for d1xdgb_: