Lineage for d1xd7a_ (1xd7 A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 438099Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 438531Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (55 families) (S)
    contains a small beta-sheet (wing)
  5. 439170Family a.4.5.55: Transcriptional regulator Rrf2 (Pfam 02082) [109699] (1 protein)
  6. 439171Protein Hypothetical protein ywnA [109700] (1 species)
  7. 439172Species Bacillus subtilis [TaxId:1423] [109701] (1 PDB entry)
  8. 439173Domain d1xd7a_: 1xd7 A: [109566]

Details for d1xd7a_

PDB Entry: 1xd7 (more details), 2.3 Å

PDB Description: crystal structure of a putative dna binding protein

SCOP Domain Sequences for d1xd7a_:

Sequence, based on SEQRES records: (download)

>d1xd7a_ a.4.5.55 (A:) Hypothetical protein ywnA {Bacillus subtilis}
srlavaihilslismdektsseiiadsvntnpvvvrrmisllkkadiltsragvpgaslk
kdpadisllevyravqkqeelfavhenpnpkcpvgkkiqnaldetfesvqramenelask
slkdvmn

Sequence, based on observed residues (ATOM records): (download)

>d1xd7a_ a.4.5.55 (A:) Hypothetical protein ywnA {Bacillus subtilis}
srlavaihilslismdektsseiiadsvntnpvvvrrmisllkkadiltsragvpgaslk
kdpadisllevyravqknpkcpvgkkiqnaldetfesvqramenelaskslkdvmn

SCOP Domain Coordinates for d1xd7a_:

Click to download the PDB-style file with coordinates for d1xd7a_.
(The format of our PDB-style files is described here.)

Timeline for d1xd7a_: