Lineage for d1xd7a_ (1xd7 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694275Family a.4.5.55: Transcriptional regulator Rrf2 [109699] (2 proteins)
    Pfam PF02082
  6. 2694279Protein Hypothetical protein ywnA [109700] (1 species)
  7. 2694280Species Bacillus subtilis [TaxId:1423] [109701] (1 PDB entry)
    Uniprot P71036 4-130
  8. 2694281Domain d1xd7a_: 1xd7 A: [109566]
    complexed with so4

Details for d1xd7a_

PDB Entry: 1xd7 (more details), 2.3 Å

PDB Description: crystal structure of a putative dna binding protein
PDB Compounds: (A:) ywnA

SCOPe Domain Sequences for d1xd7a_:

Sequence, based on SEQRES records: (download)

>d1xd7a_ a.4.5.55 (A:) Hypothetical protein ywnA {Bacillus subtilis [TaxId: 1423]}
srlavaihilslismdektsseiiadsvntnpvvvrrmisllkkadiltsragvpgaslk
kdpadisllevyravqkqeelfavhenpnpkcpvgkkiqnaldetfesvqramenelask
slkdvmn

Sequence, based on observed residues (ATOM records): (download)

>d1xd7a_ a.4.5.55 (A:) Hypothetical protein ywnA {Bacillus subtilis [TaxId: 1423]}
srlavaihilslismdektsseiiadsvntnpvvvrrmisllkkadiltsragvpgaslk
kdpadisllevyravqknpkcpvgkkiqnaldetfesvqramenelaskslkdvmn

SCOPe Domain Coordinates for d1xd7a_:

Click to download the PDB-style file with coordinates for d1xd7a_.
(The format of our PDB-style files is described here.)

Timeline for d1xd7a_: