![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.12: Transcriptional repressor Rex, C-terminal domain [102174] (2 proteins) automatically mapped to Pfam PF02629 |
![]() | Protein Transcriptional repressor Rex, C-terminal domain [102175] (1 species) forms swapped dimer with C-terminal helices |
![]() | Species Thermus aquaticus [TaxId:271] [102176] (3 PDB entries) Uniprot Q9X2V5 CASP5 |
![]() | Domain d1xcbg2: 1xcb G:78-203 [109565] Other proteins in same PDB: d1xcba1, d1xcbb1, d1xcbc1, d1xcbd1, d1xcbe1, d1xcbf1, d1xcbg1 protein/DNA complex; complexed with ca, nad |
PDB Entry: 1xcb (more details), 2.9 Å
SCOPe Domain Sequences for d1xcbg2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xcbg2 c.2.1.12 (G:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} nrkwglcivgmgrlgsaladypgfgesfelrgffdvdpekvgrpvrggviehvdllpqrv pgrieialltvpreaaqkaadllvaagikgilnfapvvlevpkevavenvdflagltrls failnp
Timeline for d1xcbg2: