SCOPe 2.08: Domain d1xcbg2: 1xcb G:78-203

Lineage for d1xcbg2 (1xcb G:78-203)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.12: Transcriptional repressor Rex, C-terminal domain [102174] (2 proteins)
   automatically mapped to Pfam PF02629

6. Protein Transcriptional repressor Rex, C-terminal domain [102175] (1 species)
   forms swapped dimer with C-terminal helices

7. Species Thermus aquaticus [TaxId:271] [102176] (3 PDB entries)
   Uniprot Q9X2V5
   CASP5

8. Domain d1xcbg2: 1xcb G:78-203 [109565]
   Other proteins in same PDB: d1xcba1, d1xcbb1, d1xcbc1, d1xcbd1, d1xcbe1, d1xcbf1, d1xcbg1
   protein/DNA complex; complexed with ca, nad

Details for d1xcbg2

PDB Entry: 1xcb, 2.9 Å

PDB Description: x-ray structure of a rex-family repressor/nadh complex from thermus aquaticus

PDB Compounds: (G:) Redox-sensing transcriptional repressor rex

SCOPe Domain Sequences for d1xcbg2:

Sequence; same for both SEQRES and ATOM records:

>d1xcbg2 c.2.1.12 (G:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]}
nrkwglcivgmgrlgsaladypgfgesfelrgffdvdpekvgrpvrggviehvdllpqrv
pgrieialltvpreaaqkaadllvaagikgilnfapvvlevpkevavenvdflagltrls
failnp

Timeline for d1xcbg2:

• d1xcbg2 first appeared in SCOP 1.69
  
• d1xcbg2 appears in SCOPe 2.07