Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.38: Transcriptional repressor Rex, N-terminal domain [101007] (1 protein) |
Protein Transcriptional repressor Rex, N-terminal domain [101008] (1 species) AT-rich DNA-binding protein p25 |
Species Thermus aquaticus [TaxId:271] [101009] (3 PDB entries) Uniprot Q9X2V5; # CASP5 |
Domain d1xcbe1: 1xcb E:4-77 [109560] Other proteins in same PDB: d1xcba2, d1xcbb2, d1xcbc2, d1xcbd2, d1xcbe2, d1xcbf2, d1xcbg2 protein/DNA complex; complexed with ca, nad |
PDB Entry: 1xcb (more details), 2.9 Å
SCOPe Domain Sequences for d1xcbe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xcbe1 a.4.5.38 (E:4-77) Transcriptional repressor Rex, N-terminal domain {Thermus aquaticus [TaxId: 271]} peaaisrlitylrileeleaqgvhrtsseqlgelaqvtafqvrkdlsyfgsygtrgvgyt vpvlkrelrhilgl
Timeline for d1xcbe1: