Lineage for d1xcbd1 (1xcb D:4-77)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307453Family a.4.5.38: Transcriptional repressor Rex, N-terminal domain [101007] (1 protein)
  6. 2307454Protein Transcriptional repressor Rex, N-terminal domain [101008] (1 species)
    AT-rich DNA-binding protein p25
  7. 2307455Species Thermus aquaticus [TaxId:271] [101009] (3 PDB entries)
    Uniprot Q9X2V5; # CASP5
  8. 2307461Domain d1xcbd1: 1xcb D:4-77 [109558]
    Other proteins in same PDB: d1xcba2, d1xcbb2, d1xcbc2, d1xcbd2, d1xcbe2, d1xcbf2, d1xcbg2
    protein/DNA complex; complexed with ca, nad

Details for d1xcbd1

PDB Entry: 1xcb (more details), 2.9 Å

PDB Description: x-ray structure of a rex-family repressor/nadh complex from thermus aquaticus
PDB Compounds: (D:) Redox-sensing transcriptional repressor rex

SCOPe Domain Sequences for d1xcbd1:

Sequence, based on SEQRES records: (download)

>d1xcbd1 a.4.5.38 (D:4-77) Transcriptional repressor Rex, N-terminal domain {Thermus aquaticus [TaxId: 271]}
peaaisrlitylrileeleaqgvhrtsseqlgelaqvtafqvrkdlsyfgsygtrgvgyt
vpvlkrelrhilgl

Sequence, based on observed residues (ATOM records): (download)

>d1xcbd1 a.4.5.38 (D:4-77) Transcriptional repressor Rex, N-terminal domain {Thermus aquaticus [TaxId: 271]}
peaaisrlitylrileeleaqgvhrtsseqlgelaqvtafqvrkdlsyfgsygytvpvlk
relrhilgl

SCOPe Domain Coordinates for d1xcbd1:

Click to download the PDB-style file with coordinates for d1xcbd1.
(The format of our PDB-style files is described here.)

Timeline for d1xcbd1: