Lineage for d1xcbb2 (1xcb B:78-203)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. Family c.2.1.12: Transcriptional repressor Rex, C-terminal domain [102174] (2 proteins)
    automatically mapped to Pfam PF02629
  6. Protein Transcriptional repressor Rex, C-terminal domain [102175] (1 species)
    forms swapped dimer with C-terminal helices
  7. Species Thermus aquaticus [TaxId:271] [102176] (3 PDB entries)
    Uniprot Q9X2V5
    CASP5
  8. Domain d1xcbb2: 1xcb B:78-203 [109555]
    Other proteins in same PDB: d1xcba1, d1xcbb1, d1xcbc1, d1xcbd1, d1xcbe1, d1xcbf1, d1xcbg1
    protein/DNA complex; complexed with ca, nad

Details for d1xcbb2

PDB Entry: 1xcb (more details), 2.9 Å

PDB Description: x-ray structure of a rex-family repressor/nadh complex from thermus aquaticus
PDB Compounds: (B:) Redox-sensing transcriptional repressor rex

SCOPe Domain Sequences for d1xcbb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xcbb2 c.2.1.12 (B:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]}
nrkwglcivgmgrlgsaladypgfgesfelrgffdvdpekvgrpvrggviehvdllpqrv
pgrieialltvpreaaqkaadllvaagikgilnfapvvlevpkevavenvdflagltrls
failnp

SCOPe Domain Coordinates for d1xcbb2 are not available.

Timeline for d1xcbb2:

Domains from same chain:
(mouse over for more information)
d1xcbb1
Domains from other chains:
(mouse over for more information)
d1xcba1, d1xcba2, d1xcbc1, d1xcbc2, d1xcbd1, d1xcbd2, d1xcbe1, d1xcbe2, d1xcbf1, d1xcbf2, d1xcbg1, d1xcbg2