Lineage for d1xc1d_ (1xc1 D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2913609Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2913797Protein Ferric-binding protein FbpA [53867] (7 species)
  7. 2913821Species Neisseria gonorrhoeae [TaxId:485] [53869] (5 PDB entries)
    Uniprot Q50964 23-331
  8. 2913825Domain d1xc1d_: 1xc1 D: [109546]
    complexed with zrc
    has additional insertions and/or extensions that are not grouped together

Details for d1xc1d_

PDB Entry: 1xc1 (more details), 1.51 Å

PDB Description: Oxo Zirconium(IV) Cluster in the Ferric Binding Protein (FBP)
PDB Compounds: (D:) periplasmic iron-binding protein

SCOPe Domain Sequences for d1xc1d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xc1d_ c.94.1.1 (D:) Ferric-binding protein FbpA {Neisseria gonorrhoeae [TaxId: 485]}
ditvyngqhkeaaqavadaftratgikvklnsakgdqlagqikeegsrspadvfyseqip
alatlsaanlleplpastinetrgkgvpvaakkdwvalsgrsrvvvydtrklsekdleks
vlnyatpkwknrigyvptsgafleqivaivklkgeaaalkwlkglkeygkpyaknsvalq
avengeidaalinnyywhafarekgvqnvhtrlnfvrhrdpgalvtysgaavlkssqnkd
eakkfvaflagkegqraltavraeyplnphvvstfnlepiakleapqvsattvsekehat
rlleqagmk

SCOPe Domain Coordinates for d1xc1d_:

Click to download the PDB-style file with coordinates for d1xc1d_.
(The format of our PDB-style files is described here.)

Timeline for d1xc1d_: