Lineage for d1xc0a_ (1xc0 A:)

  1. Root: SCOPe 2.03
  2. 1470528Class j: Peptides [58231] (120 folds)
  3. 1470747Fold j.6: Peptide hormones [58283] (1 superfamily)
    contains one alpha-helix
  4. 1470748Superfamily j.6.1: Peptide hormones [58284] (1 family) (S)
    this is not a true superfamily
  5. 1470749Family j.6.1.1: Peptide hormones [58285] (19 proteins)
  6. 1470826Protein Pardaxin P-4 [111505] (1 species)
  7. 1470827Species Red sea moses sole (Pardachirus marmoratus) [TaxId:31087] [111506] (1 PDB entry)
    Uniprot P81861
  8. 1470828Domain d1xc0a_: 1xc0 A: [109542]

Details for d1xc0a_

PDB Entry: 1xc0 (more details)

PDB Description: twenty lowest energy structures of pa4 by solution nmr
PDB Compounds: (A:) Pardaxin P-4

SCOPe Domain Sequences for d1xc0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xc0a_ j.6.1.1 (A:) Pardaxin P-4 {Red sea moses sole (Pardachirus marmoratus) [TaxId: 31087]}
gffalipkiissplfktllsavgsalsssggqe

SCOPe Domain Coordinates for d1xc0a_:

Click to download the PDB-style file with coordinates for d1xc0a_.
(The format of our PDB-style files is described here.)

Timeline for d1xc0a_: