![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.273: YjbQ-like [111037] (1 superfamily) beta(2)-alpha-beta(2)-alpha(2)-beta(3); contains a beta-sandwich: 7 strands in 2 sheets; trimerizes with orthogonally packed beta-sheets |
![]() | Superfamily d.273.1: YjbQ-like [111038] (2 families) ![]() |
![]() | Family d.273.1.1: YjbQ-like [111039] (5 proteins) Pfam PF01894 |
![]() | Protein B.subtilis YugU ortolog CAC0907 [111040] (1 species) |
![]() | Species Clostridium acetobutylicum [TaxId:1488] [111041] (2 PDB entries) Uniprot Q97KL0 |
![]() | Domain d1xbfa1: 1xbf A:4-132 [109538] Other proteins in same PDB: d1xbfa2, d1xbfb2, d1xbfc2 Structural genomics target complexed with so4 |
PDB Entry: 1xbf (more details), 2 Å
SCOPe Domain Sequences for d1xbfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xbfa1 d.273.1.1 (A:4-132) B.subtilis YugU ortolog CAC0907 {Clostridium acetobutylicum [TaxId: 1488]} vieyslktsnddqfiditnlvkkavdesgvsdgmavvfcphttagitinenadpdvtrdi lvnldkvfpkvgdykhvegnshahikaslmgssqqiiiengklklgtwqgiyftefdgpr drkvfvkii
Timeline for d1xbfa1:
![]() Domains from other chains: (mouse over for more information) d1xbfb1, d1xbfb2, d1xbfc1, d1xbfc2 |