Lineage for d1xb7a_ (1xb7 A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1097039Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 1097040Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 1097041Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 1097740Protein Steroid hormone receptor ERR1 [109990] (1 species)
  7. 1097741Species Human (Homo sapiens) [TaxId:9606] [109991] (3 PDB entries)
    Uniprot P11474 289-516
  8. 1097746Domain d1xb7a_: 1xb7 A: [109537]
    complexed with iod

Details for d1xb7a_

PDB Entry: 1xb7 (more details), 2.5 Å

PDB Description: x-ray structure of erralpha lbd in complex with a pgc-1alpha peptide at 2.5a resolution
PDB Compounds: (A:) Steroid hormone receptor ERR1

SCOPe Domain Sequences for d1xb7a_:

Sequence, based on SEQRES records: (download)

>d1xb7a_ a.123.1.1 (A:) Steroid hormone receptor ERR1 {Human (Homo sapiens) [TaxId: 9606]}
levlfqgpvnalvshllvvepeklyampdpagpdghlpavatlcdlfdreivvtiswaks
ipgfsslslsdqmsvlqsvwmevlvlgvaqrslplqdelafaedlvldeegaraaglgel
gaallqlvrrlqalrlereeyvllkalalansdsvhiedaeaveqlrealhealleyeag
ragpgggaerrragrllltlpllrqtagkvlahfygvklegkvpmhklflemlea

Sequence, based on observed residues (ATOM records): (download)

>d1xb7a_ a.123.1.1 (A:) Steroid hormone receptor ERR1 {Human (Homo sapiens) [TaxId: 9606]}
levlfqgpvnalvshllvvepeklyamavatlcdlfdreivvtiswaksipgfsslslsd
qmsvlqsvwmevlvlgvaqrslplqdelafaedlvldeegaraaglgelgaallqlvrrl
qalrlereeyvllkalalansdsvhiedaeaveqlrealhealleyeagrrragrllltl
pllrqtagkvlahfygvklegkvpmhklflemlea

SCOPe Domain Coordinates for d1xb7a_:

Click to download the PDB-style file with coordinates for d1xb7a_.
(The format of our PDB-style files is described here.)

Timeline for d1xb7a_: