Lineage for d1xb7a_ (1xb7 A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 448073Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 448074Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 448075Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (30 proteins)
  6. 448327Protein Steroid hormone receptor ERR1 [109990] (1 species)
  7. 448328Species Human (Homo sapiens) [TaxId:9606] [109991] (1 PDB entry)
  8. 448329Domain d1xb7a_: 1xb7 A: [109537]

Details for d1xb7a_

PDB Entry: 1xb7 (more details), 2.5 Å

PDB Description: X-ray structure of ERRalpha LBD in complex with a PGC-1alpha peptide at 2.5A resolution

SCOP Domain Sequences for d1xb7a_:

Sequence, based on SEQRES records: (download)

>d1xb7a_ a.123.1.1 (A:) Steroid hormone receptor ERR1 {Human (Homo sapiens)}
levlfqgpvnalvshllvvepeklyampdpagpdghlpavatlcdlfdreivvtiswaks
ipgfsslslsdqmsvlqsvwmevlvlgvaqrslplqdelafaedlvldeegaraaglgel
gaallqlvrrlqalrlereeyvllkalalansdsvhiedaeaveqlrealhealleyeag
ragpgggaerrragrllltlpllrqtagkvlahfygvklegkvpmhklflemlea

Sequence, based on observed residues (ATOM records): (download)

>d1xb7a_ a.123.1.1 (A:) Steroid hormone receptor ERR1 {Human (Homo sapiens)}
levlfqgpvnalvshllvvepeklyamavatlcdlfdreivvtiswaksipgfsslslsd
qmsvlqsvwmevlvlgvaqrslplqdelafaedlvldeegaraaglgelgaallqlvrrl
qalrlereeyvllkalalansdsvhiedaeaveqlrealhealleyeagrrragrllltl
pllrqtagkvlahfygvklegkvpmhklflemlea

SCOP Domain Coordinates for d1xb7a_:

Click to download the PDB-style file with coordinates for d1xb7a_.
(The format of our PDB-style files is described here.)

Timeline for d1xb7a_: