Lineage for d1xb7a1 (1xb7 A:290-516)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009311Protein Steroid hormone receptor ERR1 [109990] (1 species)
  7. 2009312Species Human (Homo sapiens) [TaxId:9606] [109991] (3 PDB entries)
    Uniprot P11474 289-516
  8. 2009317Domain d1xb7a1: 1xb7 A:290-516 [109537]
    Other proteins in same PDB: d1xb7a2
    complexed with iod

Details for d1xb7a1

PDB Entry: 1xb7 (more details), 2.5 Å

PDB Description: X-ray structure of ERRalpha LBD in complex with a PGC-1alpha peptide at 2.5A resolution
PDB Compounds: (A:) Steroid hormone receptor ERR1

SCOPe Domain Sequences for d1xb7a1:

Sequence, based on SEQRES records: (download)

>d1xb7a1 a.123.1.1 (A:290-516) Steroid hormone receptor ERR1 {Human (Homo sapiens) [TaxId: 9606]}
vnalvshllvvepeklyampdpagpdghlpavatlcdlfdreivvtiswaksipgfssls
lsdqmsvlqsvwmevlvlgvaqrslplqdelafaedlvldeegaraaglgelgaallqlv
rrlqalrlereeyvllkalalansdsvhiedaeaveqlrealhealleyeagragpggga
errragrllltlpllrqtagkvlahfygvklegkvpmhklflemlea

Sequence, based on observed residues (ATOM records): (download)

>d1xb7a1 a.123.1.1 (A:290-516) Steroid hormone receptor ERR1 {Human (Homo sapiens) [TaxId: 9606]}
vnalvshllvvepeklyamavatlcdlfdreivvtiswaksipgfsslslsdqmsvlqsv
wmevlvlgvaqrslplqdelafaedlvldeegaraaglgelgaallqlvrrlqalrlere
eyvllkalalansdsvhiedaeaveqlrealhealleyeagrrragrllltlpllrqtag
kvlahfygvklegkvpmhklflemlea

SCOPe Domain Coordinates for d1xb7a1:

Click to download the PDB-style file with coordinates for d1xb7a1.
(The format of our PDB-style files is described here.)

Timeline for d1xb7a1: