Lineage for d1xafb_ (1xaf B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3005836Fold d.194: CNF1/YfiH-like putative cysteine hydrolases [64437] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets
  4. 3005837Superfamily d.194.1: CNF1/YfiH-like putative cysteine hydrolases [64438] (3 families) (S)
  5. 3005846Family d.194.1.2: YfiH-like [111238] (5 proteins)
    Pfam PF02578; COG1496
  6. 3005853Protein Hypothetical protein yfiH [111243] (3 species)
  7. 3005859Species Shigella flexneri [TaxId:623] [111245] (2 PDB entries)
    Uniprot Q83K13
  8. 3005861Domain d1xafb_: 1xaf B: [109536]
    Structural genomics target
    complexed with act, gol, zn

Details for d1xafb_

PDB Entry: 1xaf (more details), 2.01 Å

PDB Description: Crystal Structure of Protein of Unknown Function YfiH from Shigella flexneri 2a str. 2457T
PDB Compounds: (B:) orf, conserved hypothetical protein

SCOPe Domain Sequences for d1xafb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xafb_ d.194.1.2 (B:) Hypothetical protein yfiH {Shigella flexneri [TaxId: 623]}
klivpqwplpkgvaacsstriggvslppydslnlgahcgdnpdhveenrkrlfaagnlps
kpvwleqvhgkdvlkltgepyaskradasysntpgtvcavmtadclpvlfcnragtevaa
vhagwrglcagvleetvscfadkpenilawlgpaigprafevgaevreafmavdakasaa
fiqhgdkyladiyqlarqrlanvgveqifggdrctytenetffsyrrdkttgrmasfiwl
i

SCOPe Domain Coordinates for d1xafb_:

Click to download the PDB-style file with coordinates for d1xafb_.
(The format of our PDB-style files is described here.)

Timeline for d1xafb_: