![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.194: CNF1/YfiH-like putative cysteine hydrolases [64437] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets |
![]() | Superfamily d.194.1: CNF1/YfiH-like putative cysteine hydrolases [64438] (3 families) ![]() |
![]() | Family d.194.1.2: YfiH-like [111238] (5 proteins) Pfam PF02578; COG1496 |
![]() | Protein Hypothetical protein yfiH [111243] (3 species) |
![]() | Species Shigella flexneri [TaxId:623] [111245] (2 PDB entries) Uniprot Q83K13 |
![]() | Domain d1xafb_: 1xaf B: [109536] Structural genomics target complexed with act, gol, zn |
PDB Entry: 1xaf (more details), 2.01 Å
SCOPe Domain Sequences for d1xafb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xafb_ d.194.1.2 (B:) Hypothetical protein yfiH {Shigella flexneri [TaxId: 623]} klivpqwplpkgvaacsstriggvslppydslnlgahcgdnpdhveenrkrlfaagnlps kpvwleqvhgkdvlkltgepyaskradasysntpgtvcavmtadclpvlfcnragtevaa vhagwrglcagvleetvscfadkpenilawlgpaigprafevgaevreafmavdakasaa fiqhgdkyladiyqlarqrlanvgveqifggdrctytenetffsyrrdkttgrmasfiwl i
Timeline for d1xafb_: