SCOPe 2.08: Domain d1xafa_: 1xaf A:

Lineage for d1xafa_ (1xaf A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.194: CNF1/YfiH-like putative cysteine hydrolases [64437] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets

4. Superfamily d.194.1: CNF1/YfiH-like putative cysteine hydrolases [64438] (3 families)

5. Family d.194.1.2: YfiH-like [111238] (5 proteins)
   Pfam PF02578; COG1496

6. Protein Hypothetical protein yfiH [111243] (3 species)

7. Species Shigella flexneri [TaxId:623] [111245] (2 PDB entries)
   Uniprot Q83K13

8. Domain d1xafa_: 1xaf A: [109535]
   Structural genomics target
   complexed with act, gol, zn

Details for d1xafa_

PDB Entry: 1xaf, 2.01 Å

PDB Description: Crystal Structure of Protein of Unknown Function YfiH from Shigella flexneri 2a str. 2457T

PDB Compounds: (A:) orf, conserved hypothetical protein

SCOPe Domain Sequences for d1xafa_:

Sequence; same for both SEQRES and ATOM records:

>d1xafa_ d.194.1.2 (A:) Hypothetical protein yfiH {Shigella flexneri [TaxId: 623]}
sklivpqwplpkgvaacsstriggvslppydslnlgahcgdnpdhveenrkrlfaagnlp
skpvwleqvhgkdvlkltgepyaskradasysntpgtvcavmtadclpvlfcnragteva
avhagwrglcagvleetvscfadkpenilawlgpaigprafevgaevreafmavdakasa
afiqhgdkyladiyqlarqrlanvgveqifggdrctytenetffsyrrdkttgrmasfiw
li

Timeline for d1xafa_:

• d1xafa_ first appeared in SCOP 1.69
  
• d1xafa_ appears in SCOPe 2.07