Lineage for d1xa1d_ (1xa1 D:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3012720Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 3013555Protein Regulatory protein BlaR1 [111289] (1 species)
  7. 3013556Species Staphylococcus aureus [TaxId:1280] [111290] (3 PDB entries)
    Uniprot P18357 338-582 ! Uniprot P18357 334-581 ! Uniprot P18357 338-583
  8. 3013560Domain d1xa1d_: 1xa1 D: [109532]
    complexed with po4, pop

Details for d1xa1d_

PDB Entry: 1xa1 (more details), 1.8 Å

PDB Description: Crystal structure of the sensor domain of BlaR1 from Staphylococcus aureus in its apo form
PDB Compounds: (D:) regulatory protein blar1

SCOPe Domain Sequences for d1xa1d_:

Sequence, based on SEQRES records: (download)

>d1xa1d_ e.3.1.1 (D:) Regulatory protein BlaR1 {Staphylococcus aureus [TaxId: 1280]}
ynykkplhndyqildkskifgsnsgsfvmysmkkdkyyiynekesrkryspnstykiyla
mfgldrhiindensrmswnhkhypfdawnkeqdlntamqnsvnwyferisdqipknytat
qlkqlnygnknlgsyksywmedslkisnleqvivfknmmeqnnhfskkaknqlsssllik
knekyelygktgtgivngkynngwfvgyvitnhdkyyfathlsdgkpsgknaelisekil
kemgvl

Sequence, based on observed residues (ATOM records): (download)

>d1xa1d_ e.3.1.1 (D:) Regulatory protein BlaR1 {Staphylococcus aureus [TaxId: 1280]}
ynykkplhndyqildkskifgsnsgsfvmysmkkdkyyiynekesrkryspnstykiyla
mfgldrhiinsrmwnhkhypfdawnkeqdlntamqnsvnwyferisdqipknytatqlkq
lnygnknlgsyksywmedslkisnleqvivfknmmenhfskkaknqlsssllikknekye
lygktgtgivngkynngwfvgyvitnhdkyyfathlsdgkpsgknaelisekilkemgvl

SCOPe Domain Coordinates for d1xa1d_:

Click to download the PDB-style file with coordinates for d1xa1d_.
(The format of our PDB-style files is described here.)

Timeline for d1xa1d_: