Lineage for d1x9la1 (1x9l A:1-145)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2376992Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2378387Superfamily b.2.10: DR1885-like metal-binding protein [110087] (1 family) (S)
  5. 2378388Family b.2.10.1: DR1885-like metal-binding protein [110088] (1 protein)
    Pfam PF04314
  6. 2378389Protein Hypothetical protein DR1885 [110089] (1 species)
  7. 2378390Species Deinococcus radiodurans [TaxId:1299] [110090] (2 PDB entries)
    Uniprot Q9RT80 35-178
  8. 2378392Domain d1x9la1: 1x9l A:1-145 [109528]
    Other proteins in same PDB: d1x9la2
    complexed with cu1

Details for d1x9la1

PDB Entry: 1x9l (more details)

PDB Description: Solution structure of CuI-DR1885 from Deinococcus Radiodurans
PDB Compounds: (A:) CuI-DR1885

SCOPe Domain Sequences for d1x9la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x9la1 b.2.10.1 (A:1-145) Hypothetical protein DR1885 {Deinococcus radiodurans [TaxId: 1299]}
mghtmpahtppaqtapaaqkagaqalpvtvqgatvaavppsirdtaaymtltnksdqpik
lvgaatplatspmlmttthsggmagmkmvpwltipargtltlqrdgdhvmlmglkrplkv
getvnitlkatdgrtlnvaatvkkn

SCOPe Domain Coordinates for d1x9la1:

Click to download the PDB-style file with coordinates for d1x9la1.
(The format of our PDB-style files is described here.)

Timeline for d1x9la1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1x9la2