SCOP 1.71: Domain d1x9la_: 1x9l A:

Lineage for d1x9la_ (1x9l A:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.10: DR1885-like metal-binding protein [110087] (1 family)

5. Family b.2.10.1: DR1885-like metal-binding protein [110088] (1 protein)
   Pfam 04314

6. Protein Hypothetical protein DR1885 [110089] (1 species)

7. Species Deinococcus radiodurans [TaxId:1299] [110090] (2 PDB entries)

8. Domain d1x9la_: 1x9l A: [109528]
   complexed with cu1

Details for d1x9la_

PDB Entry: 1x9l

PDB Description: Solution structure of CuI-DR1885 from Deinococcus Radiodurans

SCOP Domain Sequences for d1x9la_:

Sequence; same for both SEQRES and ATOM records:

>d1x9la_ b.2.10.1 (A:) Hypothetical protein DR1885 {Deinococcus radiodurans}
mghtmpahtppaqtapaaqkagaqalpvtvqgatvaavppsirdtaaymtltnksdqpik
lvgaatplatspmlmttthsggmagmkmvpwltipargtltlqrdgdhvmlmglkrplkv
getvnitlkatdgrtlnvaatvkkniegr

Timeline for d1x9la_:

• d1x9la_ first appeared in SCOP 1.69
  
• d1x9la_ appears in SCOP 1.73
  
• d1x9la_ appears in the current release, SCOPe 2.08, called d1x9la1