Lineage for d1x9la_ (1x9l A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 456653Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 457071Superfamily b.2.10: DR1885-like metal-binding protein (Pfam 04314) [110087] (1 family) (S)
  5. 457072Family b.2.10.1: DR1885-like metal-binding protein (Pfam 04314) [110088] (1 protein)
  6. 457073Protein Hypothetical protein DR1885 [110089] (1 species)
  7. 457074Species Deinococcus radiodurans [TaxId:1299] [110090] (2 PDB entries)
  8. 457075Domain d1x9la_: 1x9l A: [109528]

Details for d1x9la_

PDB Entry: 1x9l (more details)

PDB Description: Solution structure of CuI-DR1885 from Deinococcus Radiodurans

SCOP Domain Sequences for d1x9la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x9la_ b.2.10.1 (A:) Hypothetical protein DR1885 {Deinococcus radiodurans}
mghtmpahtppaqtapaaqkagaqalpvtvqgatvaavppsirdtaaymtltnksdqpik
lvgaatplatspmlmttthsggmagmkmvpwltipargtltlqrdgdhvmlmglkrplkv
getvnitlkatdgrtlnvaatvkkniegr

SCOP Domain Coordinates for d1x9la_:

Click to download the PDB-style file with coordinates for d1x9la_.
(The format of our PDB-style files is described here.)

Timeline for d1x9la_: