SCOPe 2.08: Domain d1x9la1: 1x9l A:1-145

Lineage for d1x9la1 (1x9l A:1-145)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.10: DR1885-like metal-binding protein [110087] (1 family)

5. Family b.2.10.1: DR1885-like metal-binding protein [110088] (1 protein)
   Pfam PF04314

6. Protein Hypothetical protein DR1885 [110089] (1 species)

7. Species Deinococcus radiodurans [TaxId:1299] [110090] (2 PDB entries)
   Uniprot Q9RT80 35-178

8. Domain d1x9la1: 1x9l A:1-145 [109528]
   Other proteins in same PDB: d1x9la2
   complexed with cu1

Details for d1x9la1

PDB Entry: 1x9l

PDB Description: Solution structure of CuI-DR1885 from Deinococcus Radiodurans

PDB Compounds: (A:) CuI-DR1885

SCOPe Domain Sequences for d1x9la1:

Sequence; same for both SEQRES and ATOM records:

>d1x9la1 b.2.10.1 (A:1-145) Hypothetical protein DR1885 {Deinococcus radiodurans [TaxId: 1299]}
mghtmpahtppaqtapaaqkagaqalpvtvqgatvaavppsirdtaaymtltnksdqpik
lvgaatplatspmlmttthsggmagmkmvpwltipargtltlqrdgdhvmlmglkrplkv
getvnitlkatdgrtlnvaatvkkn

Timeline for d1x9la1:

• d1x9la1 first appeared in SCOP 1.69, called d1x9la_
  
• d1x9la1 appears in SCOPe 2.07