Lineage for d1x9ga_ (1x9g A:)
- Root: SCOP 1.69
Class c: Alpha and beta proteins (a/b) [51349] (136 folds) 
Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (1 family) 
Family c.33.1.3: Isochorismatase-like hydrolases [100948] (6 proteins) 
Protein Ribonuclease MAR1 [110502] (1 species) Species Leishmania donavani [110503] (1 PDB entry) 
Domain d1x9ga_: 1x9g A: [109527]
Details for d1x9ga_
PDB Entry: 1x9g (more details), 2.41 Å
PDB Description: putative mar1 ribonuclease from leishmania donovani
SCOP Domain Sequences for d1x9ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x9ga_ c.33.1.3 (A:) Ribonuclease MAR1 {Leishmania donavani}
msrlmphyskgktaflcvdlqeafskrienfancvfvanrlarlhevvpentkyivtehy
pkglgrivpeitlpktahliektrfscvvpqveelledvdnavvfgieghacilqtvadl
ldmnkrvflpkdglgsqkktdfkaaiklmsswgpnceittsesillqmtkdamdpnfkri
skllkeeppipl
SCOP Domain Coordinates for d1x9ga_:
Click to download the PDB-style file with coordinates for d1x9ga_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1x9ga_:
- d1x9ga_ is new in SCOP 1.69
- d1x9ga_ appears in SCOP 1.71
- d1x9ga_ appears in the current release, SCOPe 2.08, called d1x9ga1
View in 3D