SCOPe 2.08: Domain d1x9ga1: 1x9g A:2-192

Lineage for d1x9ga1 (1x9g A:2-192)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families)

5. Family c.33.1.3: Isochorismatase-like hydrolases [100948] (7 proteins)

6. Protein Ribonuclease MAR1 [110502] (2 species)

7. Species Leishmania donovani [TaxId:5661] [110503] (1 PDB entry)
   Uniprot O77166 # 89% sequence identity; Leishmania tarentolae TaxID:5689

8. Domain d1x9ga1: 1x9g A:2-192 [109527]
   Other proteins in same PDB: d1x9ga2

Details for d1x9ga1

PDB Entry: 1x9g, 2.41 Å

PDB Description: putative mar1 ribonuclease from leishmania donovani

PDB Compounds: (A:) putative mar1

SCOPe Domain Sequences for d1x9ga1:

Sequence; same for both SEQRES and ATOM records:

>d1x9ga1 c.33.1.3 (A:2-192) Ribonuclease MAR1 {Leishmania donovani [TaxId: 5661]}
srlmphyskgktaflcvdlqeafskrienfancvfvanrlarlhevvpentkyivtehyp
kglgrivpeitlpktahliektrfscvvpqveelledvdnavvfgieghacilqtvadll
dmnkrvflpkdglgsqkktdfkaaiklmsswgpnceittsesillqmtkdamdpnfkris
kllkeeppipl

Timeline for d1x9ga1:

• d1x9ga1 first appeared in SCOP 1.69, called d1x9ga_
  
• d1x9ga1 appears in SCOPe 2.07