![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) ![]() |
![]() | Family c.33.1.3: Isochorismatase-like hydrolases [100948] (7 proteins) |
![]() | Protein Ribonuclease MAR1 [110502] (2 species) |
![]() | Species Leishmania donovani [TaxId:5661] [110503] (1 PDB entry) Uniprot O77166 # 89% sequence identity; Leishmania tarentolae TaxID:5689 |
![]() | Domain d1x9ga1: 1x9g A:2-192 [109527] Other proteins in same PDB: d1x9ga2 |
PDB Entry: 1x9g (more details), 2.41 Å
SCOPe Domain Sequences for d1x9ga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x9ga1 c.33.1.3 (A:2-192) Ribonuclease MAR1 {Leishmania donovani [TaxId: 5661]} srlmphyskgktaflcvdlqeafskrienfancvfvanrlarlhevvpentkyivtehyp kglgrivpeitlpktahliektrfscvvpqveelledvdnavvfgieghacilqtvadll dmnkrvflpkdglgsqkktdfkaaiklmsswgpnceittsesillqmtkdamdpnfkris kllkeeppipl
Timeline for d1x9ga1: