Lineage for d1x94b_ (1x94 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140243Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 2140244Superfamily c.80.1: SIS domain [53697] (4 families) (S)
  5. 2140400Family c.80.1.3: mono-SIS domain [69599] (6 protein domains)
    dimer of mono-domain subunits
  6. 2140416Protein Phosphoheptose isomerase GmhA1 [110723] (4 species)
  7. 2140430Species Vibrio cholerae [TaxId:666] [110725] (1 PDB entry)
    Uniprot Q9KPY2
  8. 2140432Domain d1x94b_: 1x94 B: [109523]
    Structural genomics target

Details for d1x94b_

PDB Entry: 1x94 (more details), 2.5 Å

PDB Description: Crystal Structure of a Hypothetical protein
PDB Compounds: (B:) putative Phosphoheptose isomerase

SCOPe Domain Sequences for d1x94b_:

Sequence, based on SEQRES records: (download)

>d1x94b_ c.80.1.3 (B:) Phosphoheptose isomerase GmhA1 {Vibrio cholerae [TaxId: 666]}
myqdlirselteaadvlqkflsddhniaqieaaakliadsfkqggkvlscgnggshcdam
hfaeeltgryrenrpgypgiaisdpshlscvsndfgydyvfsryveavgakgdvlfglst
sgnsgnilkaieaakakgmktialtgkdggkmagladveirvphfgyadriqevhikiih
iiiqliekema

Sequence, based on observed residues (ATOM records): (download)

>d1x94b_ c.80.1.3 (B:) Phosphoheptose isomerase GmhA1 {Vibrio cholerae [TaxId: 666]}
myqdlirselteaadvlqkflsddhniaqieaaakliadsfkqggkvlscgnggshcdam
hfaeeltgryrenrpgypgiaidyvfsryveavgakgdvlfglstsgnsgnilkaieaak
akgmktialtgkdggkmagladveirvphfgyadriqevhikiihiiiqliekema

SCOPe Domain Coordinates for d1x94b_:

Click to download the PDB-style file with coordinates for d1x94b_.
(The format of our PDB-style files is described here.)

Timeline for d1x94b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1x94a_