Lineage for d1x94a_ (1x94 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2908082Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 2908083Superfamily c.80.1: SIS domain [53697] (4 families) (S)
  5. 2908254Family c.80.1.3: mono-SIS domain [69599] (6 proteins)
    dimer of mono-domain subunits
  6. 2908270Protein Phosphoheptose isomerase GmhA1 [110723] (4 species)
  7. 2908284Species Vibrio cholerae [TaxId:666] [110725] (1 PDB entry)
    Uniprot Q9KPY2
  8. 2908285Domain d1x94a_: 1x94 A: [109522]
    Structural genomics target

Details for d1x94a_

PDB Entry: 1x94 (more details), 2.5 Å

PDB Description: crystal structure of a hypothetical protein
PDB Compounds: (A:) putative Phosphoheptose isomerase

SCOPe Domain Sequences for d1x94a_:

Sequence, based on SEQRES records: (download)

>d1x94a_ c.80.1.3 (A:) Phosphoheptose isomerase GmhA1 {Vibrio cholerae [TaxId: 666]}
myqdlirselteaadvlqkflsddhniaqieaaakliadsfkqggkvlscgnggshcdam
hfaeeltgryrenrpgypgiaisdpshlscvsndfgydyvfsryveavgakgdvlfglst
sgnsgnilkaieaakakgmktialtgkdggkmagladveirvphfgyadriqevhikiih
iiiqliekema

Sequence, based on observed residues (ATOM records): (download)

>d1x94a_ c.80.1.3 (A:) Phosphoheptose isomerase GmhA1 {Vibrio cholerae [TaxId: 666]}
myqdlirselteaadvlqkflsddhniaqieaaakliadsfkqggkvlscgnggshcdam
hfaeeltgryrenrpgypgiaidyvfsryveavgakgdvlfglstsgnsgnilkaieaak
akgmktialtgkdggkmagladveirvphfgyadriqevhikiihiiiqliekema

SCOPe Domain Coordinates for d1x94a_:

Click to download the PDB-style file with coordinates for d1x94a_.
(The format of our PDB-style files is described here.)

Timeline for d1x94a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1x94b_