Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (43 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein RhoA [52612] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [52613] (11 PDB entries) |
Domain d1x86h_: 1x86 H: [109515] Other proteins in same PDB: d1x86a1, d1x86a2, d1x86c1, d1x86c2, d1x86e1, d1x86e2, d1x86g1, d1x86g2 |
PDB Entry: 1x86 (more details), 3.22 Å
SCOP Domain Sequences for d1x86h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x86h_ c.37.1.8 (H:) RhoA {Human (Homo sapiens)} airkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwdtag qedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlr ndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalqa
Timeline for d1x86h_: