Lineage for d1x86g1 (1x86 G:766-994)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719559Fold a.87: DBL homology domain (DH-domain) [48064] (1 superfamily)
    multihelical; core: 5-helical bundle
  4. 2719560Superfamily a.87.1: DBL homology domain (DH-domain) [48065] (2 families) (S)
    automatically mapped to Pfam PF00621
  5. 2719561Family a.87.1.1: DBL homology domain (DH-domain) [48066] (10 proteins)
    Pfam PF00621
  6. 2719601Protein Rho guanine nucleotide exchange factor 12 [109937] (1 species)
  7. 2719602Species Human (Homo sapiens), gamma isoform [TaxId:9606] [109938] (2 PDB entries)
    Uniprot Q9NZN5 766-1138
  8. 2719607Domain d1x86g1: 1x86 G:766-994 [109513]
    Other proteins in same PDB: d1x86a2, d1x86b_, d1x86c2, d1x86d_, d1x86e2, d1x86f_, d1x86g2, d1x86h_
    complexed with po4

Details for d1x86g1

PDB Entry: 1x86 (more details), 3.22 Å

PDB Description: crystal structure of the dh/ph domains of leukemia-associated rhogef in complex with rhoa
PDB Compounds: (G:) Rho guanine nucleotide exchange factor 12

SCOPe Domain Sequences for d1x86g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x86g1 a.87.1.1 (G:766-994) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
ppnwqqlvsrevllglkpceikrqevinelfyterahvrtlkvldqvfyqrvsregilsp
selrkifsnledilqlhiglneqmkavrkrnetsvidqigedlltwfsgpgeeklkhaaa
tfcsnqpfalemiksrqkkdsrfqtfvqdaesnplcrrlqlkdiiptqmqrltkypllld
niakytewpterekvkkaadhcrqilnfvnqavkeaenkqrledyqrrl

SCOPe Domain Coordinates for d1x86g1:

Click to download the PDB-style file with coordinates for d1x86g1.
(The format of our PDB-style files is described here.)

Timeline for d1x86g1: