SCOP 1.71: Domain d1x86e2: 1x86 E:1020-1133

Lineage for d1x86e2 (1x86 E:1020-1133)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.55: PH domain-like [50728] (1 superfamily)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (9 families)

5. Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (30 proteins)
   Pfam 00169

6. Protein Rho guanine nucleotide exchange factor 12 [110270] (1 species)

7. Species Human (Homo sapiens), gamma isoform [TaxId:9606] [110271] (2 PDB entries)

8. Domain d1x86e2: 1x86 E:1020-1133 [109511]
   Other proteins in same PDB: d1x86a1, d1x86b_, d1x86c1, d1x86d_, d1x86e1, d1x86f_, d1x86g1, d1x86h_

Details for d1x86e2

PDB Entry: 1x86, 3.22 Å

PDB Description: crystal structure of the dh/ph domains of leukemia-associated rhogef in complex with rhoa

SCOP Domain Sequences for d1x86e2:

Sequence, based on SEQRES records:

>d1x86e2 b.55.1.1 (E:1020-1133) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform}
mihegplvwkvnrdktidlytllledilvllqkqddrlvlrchskilastadskhtfspv
iklstvlvrqvatdnkalfvismsdngaqiyelvaqtvsektvwqdlicrmaas

Sequence, based on observed residues (ATOM records):

>d1x86e2 b.55.1.1 (E:1020-1133) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform}
mihegplvwkvnrdktidlytllledilvllqkqddrlvspviklstvlvrqvnkalfvi
sqiyelvaqtvsektvwqdlicrmaas

Timeline for d1x86e2:

• d1x86e2 first appeared in SCOP 1.69
  
• d1x86e2 appears in SCOP 1.73
  
• d1x86e2 appears in the current release, SCOPe 2.08