Lineage for d1x86d_ (1x86 D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2474875Family c.37.1.8: G proteins [52592] (80 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2475951Protein RhoA [52612] (1 species)
  7. 2475952Species Human (Homo sapiens) [TaxId:9606] [52613] (36 PDB entries)
    Uniprot P61586 2-181
  8. 2476003Domain d1x86d_: 1x86 D: [109509]
    Other proteins in same PDB: d1x86a1, d1x86a2, d1x86c1, d1x86c2, d1x86e1, d1x86e2, d1x86g1, d1x86g2
    complexed with po4

Details for d1x86d_

PDB Entry: 1x86 (more details), 3.22 Å

PDB Description: crystal structure of the dh/ph domains of leukemia-associated rhogef in complex with rhoa
PDB Compounds: (D:) transforming protein rhoa

SCOPe Domain Sequences for d1x86d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x86d_ c.37.1.8 (D:) RhoA {Human (Homo sapiens) [TaxId: 9606]}
aairkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwdta
gqedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdl
rndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalqa

SCOPe Domain Coordinates for d1x86d_:

Click to download the PDB-style file with coordinates for d1x86d_.
(The format of our PDB-style files is described here.)

Timeline for d1x86d_: