Lineage for d1x86c2 (1x86 C:1020-1133)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 467364Fold b.55: PH domain-like [50728] (1 superfamily)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 467365Superfamily b.55.1: PH domain-like [50729] (9 families) (S)
  5. 467366Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (24 proteins)
  6. 467449Protein Rho guanine nucleotide exchange factor 12 [110270] (1 species)
  7. 467450Species Human (Homo sapiens), gamma isoform [TaxId:9606] [110271] (2 PDB entries)
  8. 467453Domain d1x86c2: 1x86 C:1020-1133 [109508]
    Other proteins in same PDB: d1x86a1, d1x86b_, d1x86c1, d1x86d_, d1x86e1, d1x86f_, d1x86g1, d1x86h_

Details for d1x86c2

PDB Entry: 1x86 (more details), 3.22 Å

PDB Description: crystal structure of the dh/ph domains of leukemia-associated rhogef in complex with rhoa

SCOP Domain Sequences for d1x86c2:

Sequence, based on SEQRES records: (download)

>d1x86c2 b.55.1.1 (C:1020-1133) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform}
mihegplvwkvnrdktidlytllledilvllqkqddrlvlrchskilastadskhtfspv
iklstvlvrqvatdnkalfvismsdngaqiyelvaqtvsektvwqdlicrmaas

Sequence, based on observed residues (ATOM records): (download)

>d1x86c2 b.55.1.1 (C:1020-1133) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform}
mihegplvwkvnrdktidlytllledilvllqkqddrlvlrchstfspviklstvlvrqv
atdnkalfvismsdngaqiyelvaqtvsektvwqdlicrmaas

SCOP Domain Coordinates for d1x86c2:

Click to download the PDB-style file with coordinates for d1x86c2.
(The format of our PDB-style files is described here.)

Timeline for d1x86c2: