SCOPe 2.08: Domain d1x86a1: 1x86 A:766-999

Lineage for d1x86a1 (1x86 A:766-999)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.87: DBL homology domain (DH-domain) [48064] (1 superfamily)
   multihelical; core: 5-helical bundle

4. Superfamily a.87.1: DBL homology domain (DH-domain) [48065] (2 families)
   automatically mapped to Pfam PF00621

5. Family a.87.1.1: DBL homology domain (DH-domain) [48066] (10 proteins)
   Pfam PF00621

6. Protein Rho guanine nucleotide exchange factor 12 [109937] (1 species)

7. Species Human (Homo sapiens), gamma isoform [TaxId:9606] [109938] (2 PDB entries)
   Uniprot Q9NZN5 766-1138

8. Domain d1x86a1: 1x86 A:766-999 [109504]
   Other proteins in same PDB: d1x86a2, d1x86b_, d1x86c2, d1x86d_, d1x86e2, d1x86f_, d1x86g2, d1x86h_
   complexed with po4

Details for d1x86a1

PDB Entry: 1x86, 3.22 Å

PDB Description: crystal structure of the dh/ph domains of leukemia-associated rhogef in complex with rhoa

PDB Compounds: (A:) Rho guanine nucleotide exchange factor 12

SCOPe Domain Sequences for d1x86a1:

Sequence; same for both SEQRES and ATOM records:

>d1x86a1 a.87.1.1 (A:766-999) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
ppnwqqlvsrevllglkpceikrqevinelfyterahvrtlkvldqvfyqrvsregilsp
selrkifsnledilqlhiglneqmkavrkrnetsvidqigedlltwfsgpgeeklkhaaa
tfcsnqpfalemiksrqkkdsrfqtfvqdaesnplcrrlqlkdiiptqmqrltkypllld
niakytewpterekvkkaadhcrqilnfvnqavkeaenkqrledyqrrldtssl

Timeline for d1x86a1:

• d1x86a1 first appeared in SCOP 1.69
  
• d1x86a1 appears in SCOPe 2.07