SCOPe 2.06: Domain d1x7vc1: 1x7v C:1-97

Lineage for d1x7vc1 (1x7v C:1-97)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.11: PA3566-like [110970] (5 proteins)
   subfamily of Pfam PF03992

6. Protein Hypothetical protein PA3566 [110971] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [110972] (1 PDB entry)
   Uniprot Q9HY51

8. Domain d1x7vc1: 1x7v C:1-97 [109503]
   Other proteins in same PDB: d1x7va2, d1x7vb2, d1x7vc2
   Structural genomics target
   complexed with so4

Details for d1x7vc1

PDB Entry: 1x7v, 1.78 Å

PDB Description: Crystal structure of PA3566 from Pseudomonas aeruginosa

PDB Compounds: (C:) PA3566 protein

SCOPe Domain Sequences for d1x7vc1:

Sequence; same for both SEQRES and ATOM records:

>d1x7vc1 d.58.4.11 (C:1-97) Hypothetical protein PA3566 {Pseudomonas aeruginosa [TaxId: 287]}
mstpltliatitaapghaealerelralvapsraeagclqydlhqdrhdshlfymieqwr
ddaalerhqntehflrfsrgneallqnvkidqlyrla

Timeline for d1x7vc1:

• d1x7vc1 first appeared in SCOP 1.69, called d1x7vc_
  
• d1x7vc1 was called d1x7vc_ in SCOPe 2.05
  
• d1x7vc1 appears in SCOPe 2.07
  
• d1x7vc1 appears in the current release, SCOPe 2.08