| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) ![]() dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
| Family d.58.4.11: PA3566-like [110970] (5 proteins) subfamily of Pfam PF03992 |
| Protein Hypothetical protein PA3566 [110971] (1 species) |
| Species Pseudomonas aeruginosa [TaxId:287] [110972] (1 PDB entry) Uniprot Q9HY51 |
| Domain d1x7vc_: 1x7v C: [109503] Structural genomics target complexed with so4 |
PDB Entry: 1x7v (more details), 1.78 Å
SCOPe Domain Sequences for d1x7vc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x7vc_ d.58.4.11 (C:) Hypothetical protein PA3566 {Pseudomonas aeruginosa [TaxId: 287]}
ghmstpltliatitaapghaealerelralvapsraeagclqydlhqdrhdshlfymieq
wrddaalerhqntehflrfsrgneallqnvkidqlyrla
Timeline for d1x7vc_: