SCOP 1.71: Domain d1x7vc_: 1x7v C:

Lineage for d1x7vc_ (1x7v C:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (13 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.11: PA3566-like [110970] (3 proteins)
   subfamily of Pfam 03992

6. Protein Hypothetical protein PA3566 [110971] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [110972] (1 PDB entry)

8. Domain d1x7vc_: 1x7v C: [109503]
   Structural genomics target
   complexed with so4

Details for d1x7vc_

PDB Entry: 1x7v, 1.78 Å

PDB Description: Crystal structure of PA3566 from Pseudomonas aeruginosa

SCOP Domain Sequences for d1x7vc_:

Sequence; same for both SEQRES and ATOM records:

>d1x7vc_ d.58.4.11 (C:) Hypothetical protein PA3566 {Pseudomonas aeruginosa}
ghmstpltliatitaapghaealerelralvapsraeagclqydlhqdrhdshlfymieq
wrddaalerhqntehflrfsrgneallqnvkidqlyrla

Timeline for d1x7vc_:

• d1x7vc_ first appeared in SCOP 1.69
  
• d1x7vc_ appears in SCOP 1.73
  
• d1x7vc_ appears in the current release, SCOPe 2.08, called d1x7vc1