Lineage for d1x7vc1 (1x7v C:1-97)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949708Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2949910Family d.58.4.11: PA3566-like [110970] (5 proteins)
    subfamily of Pfam PF03992
  6. 2949927Protein Hypothetical protein PA3566 [110971] (1 species)
  7. 2949928Species Pseudomonas aeruginosa [TaxId:287] [110972] (1 PDB entry)
    Uniprot Q9HY51
  8. 2949931Domain d1x7vc1: 1x7v C:1-97 [109503]
    Other proteins in same PDB: d1x7va2, d1x7vb2, d1x7vc2
    Structural genomics target
    complexed with so4

Details for d1x7vc1

PDB Entry: 1x7v (more details), 1.78 Å

PDB Description: Crystal structure of PA3566 from Pseudomonas aeruginosa
PDB Compounds: (C:) PA3566 protein

SCOPe Domain Sequences for d1x7vc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x7vc1 d.58.4.11 (C:1-97) Hypothetical protein PA3566 {Pseudomonas aeruginosa [TaxId: 287]}
mstpltliatitaapghaealerelralvapsraeagclqydlhqdrhdshlfymieqwr
ddaalerhqntehflrfsrgneallqnvkidqlyrla

SCOPe Domain Coordinates for d1x7vc1:

Click to download the PDB-style file with coordinates for d1x7vc1.
(The format of our PDB-style files is described here.)

Timeline for d1x7vc1: