SCOP 1.73: Domain d1x7vb_: 1x7v B:

Lineage for d1x7vb_ (1x7v B:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (17 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.11: PA3566-like [110970] (3 proteins)
   subfamily of Pfam PF03992

6. Protein Hypothetical protein PA3566 [110971] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [110972] (1 PDB entry)

8. Domain d1x7vb_: 1x7v B: [109502]

Details for d1x7vb_

PDB Entry: 1x7v, 1.78 Å

PDB Description: Crystal structure of PA3566 from Pseudomonas aeruginosa

PDB Compounds: (B:) PA3566 protein

SCOP Domain Sequences for d1x7vb_:

Sequence; same for both SEQRES and ATOM records:

>d1x7vb_ d.58.4.11 (B:) Hypothetical protein PA3566 {Pseudomonas aeruginosa [TaxId: 287]}
hmstpltliatitaapghaealerelralvapsraeagclqydlhqdrhdshlfymieqw
rddaalerhqntehflrfsrgneallqnvkidqlyrla

Timeline for d1x7vb_:

• d1x7vb_ first appeared in SCOP 1.69
  
• d1x7vb_ appears in SCOP 1.71
  
• d1x7vb_ appears in SCOP 1.75
  
• d1x7vb_ appears in the current release, SCOPe 2.08, called d1x7vb1