![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) ![]() dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
![]() | Family d.58.4.11: PA3566-like [110970] (5 proteins) subfamily of Pfam PF03992 |
![]() | Protein Hypothetical protein PA3566 [110971] (1 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [110972] (1 PDB entry) Uniprot Q9HY51 |
![]() | Domain d1x7va1: 1x7v A:1-97 [109501] Other proteins in same PDB: d1x7va2, d1x7vb2, d1x7vc2 Structural genomics target complexed with so4 |
PDB Entry: 1x7v (more details), 1.78 Å
SCOPe Domain Sequences for d1x7va1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x7va1 d.58.4.11 (A:1-97) Hypothetical protein PA3566 {Pseudomonas aeruginosa [TaxId: 287]} mstpltliatitaapghaealerelralvapsraeagclqydlhqdrhdshlfymieqwr ddaalerhqntehflrfsrgneallqnvkidqlyrla
Timeline for d1x7va1:
![]() Domains from other chains: (mouse over for more information) d1x7vb1, d1x7vb2, d1x7vc1, d1x7vc2 |