![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.10: DR1885-like metal-binding protein [110087] (1 family) ![]() |
![]() | Family b.2.10.1: DR1885-like metal-binding protein [110088] (1 protein) Pfam 04314 |
![]() | Protein Hypothetical protein DR1885 [110089] (1 species) |
![]() | Species Deinococcus radiodurans [TaxId:1299] [110090] (2 PDB entries) |
![]() | Domain d1x7la_: 1x7l A: [109500] |
PDB Entry: 1x7l (more details)
SCOP Domain Sequences for d1x7la_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x7la_ b.2.10.1 (A:) Hypothetical protein DR1885 {Deinococcus radiodurans} mghtmpahtppaqtapaaqkagaqalpvtvqgatvaavppsirdtaaymtltnksdqpik lvgaatplatspmlmttthsggmagmkmvpwltipargtltlqrdgdhvmlmglkrplkv getvnitlkatdgrtlnvaatvkkniegr
Timeline for d1x7la_: