Lineage for d1x7fa2 (1x7f A:1-244)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083640Family c.1.8.12: Outer surface protein, N-terminal domain [110354] (1 protein)
    corresponds to the N-terminal part of Pfam PF05913
  6. 2083641Protein Outer surface protein, N-terminal domain [110355] (1 species)
  7. 2083642Species Bacillus cereus [TaxId:1396] [110356] (1 PDB entry)
    Uniprot Q81HJ5
  8. 2083643Domain d1x7fa2: 1x7f A:1-244 [109499]
    Other proteins in same PDB: d1x7fa1

Details for d1x7fa2

PDB Entry: 1x7f (more details), 2.3 Å

PDB Description: Crystal structure of an uncharacterized B. cereus protein
PDB Compounds: (A:) outer surface protein

SCOPe Domain Sequences for d1x7fa2:

Sequence, based on SEQRES records: (download)

>d1x7fa2 c.1.8.12 (A:1-244) Outer surface protein, N-terminal domain {Bacillus cereus [TaxId: 1396]}
merklgislypehstkekdmayisaaarhgfsriftcllsvnrpkeeivaefkeiinhak
dnnmevildvapavfdqlgisysdlsffaelgadgirldvgfdglteakmtnnpyglkie
lnvsndiaylenilshqanksaligchnfypqkftglpydyfircserfkkhgirsaafi
tshvanigpwdindglctleehrnlpievqakhlwatgliddviignayaseeeleklgn
lnry

Sequence, based on observed residues (ATOM records): (download)

>d1x7fa2 c.1.8.12 (A:1-244) Outer surface protein, N-terminal domain {Bacillus cereus [TaxId: 1396]}
merklgislypehstkekdmayisaaarhgfsriftcllsvaefkeiinhakdnnmevil
dvapavfysdlsffaelgadgirldvgfdglteakmtnnpyglkielnvsndiaylenil
shqanksaligchnfypqkftglpydyfircserfkkhgirsaafitshvanigpwdind
glctleehrnlpievqakhlwatgliddviignayaseeeleklgnlnry

SCOPe Domain Coordinates for d1x7fa2:

Click to download the PDB-style file with coordinates for d1x7fa2.
(The format of our PDB-style files is described here.)

Timeline for d1x7fa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1x7fa1