Class b: All beta proteins [48724] (177 folds) |
Fold b.62: Cyclophilin-like [50890] (1 superfamily) barrel, closed; n=8, S=10; complex topology |
Superfamily b.62.1: Cyclophilin-like [50891] (5 families) |
Family b.62.1.2: Outer surface protein, C-terminal domain [110278] (1 protein) lacks the N-terminal strand of cyclophilin but the beta-barrel (7,10) remains closed; corresponds to the C-terminal part of Pfam PF05913 |
Protein Outer surface protein, C-terminal domain [110279] (1 species) |
Species Bacillus cereus [TaxId:1396] [110280] (1 PDB entry) Uniprot Q81HJ5 |
Domain d1x7fa1: 1x7f A:245-361 [109498] Other proteins in same PDB: d1x7fa2 |
PDB Entry: 1x7f (more details), 2.3 Å
SCOPe Domain Sequences for d1x7fa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x7fa1 b.62.1.2 (A:245-361) Outer surface protein, C-terminal domain {Bacillus cereus [TaxId: 1396]} mlqlkvhfvdeatevekratlqelhvrrgditeymvrstevrkkykdydfpvresvlqer gqvvignnsfgkykgelqiilkempiderknivgtiaeeelflldyvgawtqftcve
Timeline for d1x7fa1: